Anti-Mouse CXCL1 Rabbit Recombinant Antibody Proteintech 98047-1-RR
$299.00
In stock
SKU
98047-1-RR
240268D2, chemokine (C X C motif) ligand 1, Growth-regulated alpha protein
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0303 Product name: Recombinant mouse Cxcl1 protein (N-6*HIS) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 25-96 aa of NM_008176 Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：14825 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Background Information：CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
