Anti-Mouse CD83 Rabbit Recombinant Antibody Proteintech 98119-1-RR
$299.00
In stock
SKU
98119-1-RR
241002B7, CD83 antigen, mCD83
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1387 Product name: Recombinant Mouse CD83 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-133 aa of NM_009856.3 Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12522 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Background Information：CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
