Anti-Mouse CD79a Rabbit Recombinant Antibody Proteintech 98129-1-RR
$299.00
In stock
SKU
98129-1-RR
241231F7, B-cell antigen receptor complex-associated protein alpha chain, Mb-1
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg1388 Product name: Recombinant Mouse CD79A protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-137 aa of NM_007655.3 Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR Predict reactive species | Formulation::PBS, Azide4 |
| RRID:12518 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purfication | Formulation::PBS, Azide6 |
| Background Information:CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC) (INTRA)0 |