Anti-Mouse CD69 Rabbit Recombinant Antibody Proteintech 98440-2-RR
$299.00
In stock
SKU
98440-2-RR
AIM, CD69 antigen, VEA
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3835 Product name: Recombinant Mouse CD69 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 62-199 aa of NM_001033122.3 Sequence: NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12515 | Formulation:：PBS, Azide5 |
| Storage Buffer：P37217 | Formulation:：PBS, Azide6 |
| Background Information：CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
