Anti-Mouse CD53 Rabbit Recombinant Antibody Proteintech 98436-3-RR
$299.00
In stock
SKU
98436-3-RR
Cell surface glycoprotein CD53, Leukocyte surface antigen CD53
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2684 Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 107-181 aa of NM_007651.3 Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12508 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q61451 | Formulation:：PBS, Azide6 |
| Background Information：CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
