Anti-Human CCL24/Eotaxin 2 Rabbit Recombinant Antibody Proteintech 98476-3-RR
$299.00
In stock
SKU
98476-3-RR
CCL24, Eotaxin 2, C C motif chemokine 24, C-C motif chemokine 24, CCL 24
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0395 Product name: Recombinant Human CCL24 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 27-119 aa of NM_002991 Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：6369 | Formulation:：PBS, Azide5 |
| Storage Buffer：O00175 | Formulation:：PBS, Azide6 |
| Background Information：Chemokine CCL24 is the second member of eotaxins, a group of eosinophils' selectively chemoattractants. CCL24 is constitutively expressed in fibroblasts, epithelial cells, macrophages. CCL24 has only one receptor CCR3, which mainly presents on eosinophils and was also found on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscles. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
