Anti-Mouse CD37 Rabbit Recombinant Antibody Proteintech 98443-1-RR
$299.00
In stock
SKU
98443-1-RR
Leukocyte antigen CD37, Tetraspanin 26, TSPAN26
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2729 Product name: Recombinant Mouse CD37 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 112-241 aa of NM_007645.4 Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12493 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q61470 | Formulation:：PBS, Azide6 |
| Background Information：CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
