Anti-Human CCL14 Rabbit Recombinant Antibody Proteintech 98554-1-RR
$299.00
In stock
SKU
98554-1-RR
C C motif chemokine 14, C-C motif chemokine 14, CCL-14, Chemokine CC-1/CC-3, HCC-1(1-74)
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2879 Product name: Recombinant Human CCL14 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-93 aa of NM_032963.3 Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：6358 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q16627-1 | Formulation:：PBS, Azide6 |
| Background Information：CCL14, also known as HCC-1, is a human plasma chemokine that belongs to the CC chemokine family. It was originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 is constitutively expressed in various tissues, including the spleen, bone marrow, liver, muscle, and intestine. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis (PMID: 31641099), and CCL14 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma (PMID: 39030403). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
