Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody Proteintech 98480-1-RR
$299.00
In stock
SKU
98480-1-RR
Ccl8, C-C motif chemokine 8, Ccl 8, CCL-8, chemokine (C C motif) ligand 8
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2771 Product name: Recombinant Mouse CCL8/MCP-2 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 24-97 aa of NM_021443.3 Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20307 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9Z121 | Formulation:：PBS, Azide6 |
| Background Information：The cys-cys (C-C) motif chemokine ligand 8 (CCL8, also known as MCP2) is implicated in various inflammatory processes. In bone marrow transplantation, circulating CCL8 levels positively correlate with the severity of graft-versus-host disease. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
