Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody Proteintech 98555-1-RR
$299.00
In stock
SKU
98555-1-RR
C-C motif chemokine 7, Ccl7, Fic, Intercrine/chemokine MARC, Mcp3
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg4626 Product name: Recombinant Mouse CCL7/MCP-3 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_013654.3 Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20306 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q03366 | Formulation:：PBS, Azide6 |
| Background Information：The chemokine CCL7 (MCP3) is a chemotactic factor and potent attractant of monocytes firstly characterized from the culture supernatants of MG-63 osteosarcoma cells. CCL7 is known to promote the recruitment of many innate immune cell types including monocytes and neutrophils to sites of bacterial and viral infection and eosinophils and basophils to sites of allergic inflammation. CCL7 is expressed at low levels in endothelial cells, fibroblasts and mononuclear cells and upregulated by various stimuli including viruses, type I or type II interferons (IFNs). CCL7 (MCP-3) mediates effects on a host of innate and adaptive immune cell types through binding to numerous receptors including CCR1, CCR2, CCR3, CCR5, and CCR10. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
