Anti-Mouse CCL6 Rabbit Recombinant Antibody Proteintech 98482-3-RR
$299.00
In stock
SKU
98482-3-RR
C10, C-C motif chemokine 6, CCL6(22-95), CCL6(23-95), CCL6/C10
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2957 Product name: Recombinant Mouse CCL6 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-116 aa of NM_009139.3 Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20305 | Formulation:：PBS, Azide5 |
| Storage Buffer：P27784 | Formulation:：PBS, Azide6 |
| Formulation:：PBS, Azide7 | |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
