Anti-Mouse CCL3/MIP-1 alpha Rabbit Recombinant Antibody Proteintech 98194-1-RR
$299.00
In stock
SKU
98194-1-RR
241695B10, C-C motif chemokine 3, Ccl3, Heparin-binding chemotaxis protein, L2G25B
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species | Formulation::PBS, Azide4 |
| RRID:20302 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purfication | Formulation::PBS, Azide6 |
| Background Information:Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells. | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC) (INTRA)0 |