Anti-Mouse CCL11/Eotaxin Rabbit Recombinant Antibody Proteintech 98464-1-RR
$299.00
In stock
SKU
98464-1-RR
C-C motif chemokine 11, Ccl11, Eosinophil chemotactic protein, Eotaxin, Scya11
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2400 Product name: recombinant mouse Ccl11 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_011330 Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20292 | Formulation:：PBS, Azide5 |
| Storage Buffer：P48298 | Formulation:：PBS, Azide6 |
| Background Information：CCL11 also named Eotaxin-1, was initially discovered as an eosinophil-specific chemoattractant. CCL11 plays a central role in both allergic and non-allergic inflammatory reactions by recruiting immune cells such as eosinophils,basophils and Th2 lymphocytes. CCL11 binds to the chemokine receptors CCR2, CCR3 and CCR5, with highest affinity to CCR3. High levels of CCL11 have been described in several chronic inflammatory diseases, such as allergic rhinitis, atopic dermatitis, asthma, gastrointestinal disease and rheumatoid arthritis. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
