Anti-Human TSLP Rabbit Recombinant Antibody Proteintech 98247-1-RR
$299.00
In stock
SKU
98247-1-RR
241821B2, Thymic stromal lymphopoietin
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1238 Product name: Recombinant Human TSLP protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-159 aa of NM_033035.5 Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：85480 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q969D9-1 | Formulation:：PBS, Azide6 |
| Background Information：TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
