Anti-Human TNFSF18 Rabbit Recombinant Antibody Proteintech 98403-3-RR
$299.00
In stock
SKU
98403-3-RR
Activation-inducible TNF-related ligand, AITRL, GITRL, Glucocorticoid-induced TNF-related ligand, hGITRL
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg32094 Product name: Recombinant Human TNFSF18 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: N-6*his Domain: 50-177 aa of BC069319 Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：8995 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9UNG2 | Formulation:：PBS, Azide6 |
| Background Information：TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
