Anti-Human TGFBR2 Rabbit Recombinant Antibody Proteintech 98438-1-RR
$299.00
In stock
SKU
98438-1-RR
EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II, TGF-beta receptor type-2
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2943 Product name: Recombinant Human TGFBR2 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 23-159 aa of NM_003242.5 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：7048 | Formulation:：PBS, Azide5 |
| Storage Buffer：P37173-1 | Formulation:：PBS, Azide6 |
| Background Information：TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 is a serine/threonine kinase and the primary ligand-binding receptor. After binding of the ligand TGF-β1, TGFBR2 forms a heterodimer complex with TGFBR1, causing conformational changes and signal propagation via canonical (SMAD-dependent) and non-canonical (SMAD-independent) routes. Upon translocation into the nucleus, activated SMAD complexes can interact with various transcription factors to control target gene expression (PMID: 31454892). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review