Anti-Human NCR3/NKp30 Rabbit Recombinant Antibody Proteintech 98365-2-RR
$299.00
In stock
SKU
98365-2-RR
NCR3, 1C7, CD337, LY117, MALS
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg31663 Product name: Recombinant Human NCR3 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-135 aa of BC052582 Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：259197 | Formulation:：PBS, Azide5 |
| Storage Buffer：O14931 | Formulation:：PBS, Azide6 |
| Background Information：NKp30 (CD337) (NCR3) is a 30-kDa type I transmembrane protein characterized by a single V-type immunoglobulin (Ig) extracellular domain. NKp30 expression is mostly restricted to NK cells although recent studies found this NCR to be present on the surface of additional immune cells, including γδ T cells and Innate Lymphoid Cells (ILCs). NKp30 is involved in NK cell-mediated killing of various tumor cell lines, virus-infected cells and also of autologous dendritic cells (DCs) during the so-called "editing" process. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
