PTPN18 Recombinant monoclonal antibody Proteintech 83024-1-RR
$299.00
In stock
SKU
83024-1-RR
Tyrosine-protein phosphatase non-receptor type 18, PTP HSCF, EC:3.1.3.48, Brain-derived phosphatase, BDP1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34048 Product name: Recombinant human PTPN18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-351 aa of BC052800 Sequence: VQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：PTPN18 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：PTPN18 (also called PTP-HSCF or BDP1), a member of the protein tyrosine phosphatase superfamily, has been reported to be a tumor suppressor in breast cancer by dephosphorylating HER2 and suppressing cell proliferation and invasion. In addition to the well-established role of PTPN18 in breast cancer, our previous study found that PTPN18 and CSK cooperate to inhibit the events triggered by SRC kinases. (PMID: 35982039) | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
