Integrin beta 5 Recombinant monoclonal antibody Proteintech 83514-3-RR
$299.00
In stock
SKU
83514-3-RR
ITGB5, 240401G11, Integrin beta-5, integrin, beta 5
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：Integrin beta 5 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：ITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
