EPB41L3 Recombinant monoclonal antibody Proteintech 83275-2-RR
$299.00
In stock
SKU
83275-2-RR
230501D7, 4.1B, Band 4.1-like protein 3, Band 4.1-like protein 3, N-terminally processed, DAL1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag1089 Product name: Recombinant human EPB41L3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 191-312 aa of BC008377 Sequence: MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：EPB41L3 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：EPB41L3, also known as 4.1B and DAL1, belongs to the protein 4.1 family. It is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. EPB41L3 modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (PMID: 15334060, 15737618). DAL1 loss is an early event in meningioma tumorigenesis (PMID: 10888600). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
