EFHD2 Recombinant monoclonal antibody Proteintech 83264-6-RR
$299.00
In stock
SKU
83264-6-RR
240185A8, EF-hand domain-containing protein D2, Swiprosin 1, Swiprosin-1, SWS1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：EFHD2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：EFHD2 also named Swiprosin-1, is a Ca2+ binding actin protein. The expression of EFHD2 is upregulated during the activation of immune cells, epithelial and endothelial cells. The expression of EFHD2 is regulated by diverse signaling pathways that are contingent upon the specific type of cells. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
