cIAP2 Recombinant monoclonal antibody Proteintech 84779-4-RR
$299.00
In stock
SKU
84779-4-RR
BIRC3, 242214E11, Baculoviral IAP repeat-containing protein 3, BIRC 3, C IAP2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag20500 Product name: Recombinant human BIRC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：cIAP2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
