CD3EAP Recombinant monoclonal antibody Proteintech 84139-4-RR
$299.00
In stock
SKU
84139-4-RR
241379H5, A34.5, Antisense to ERCC-1 protein, ASE1, ASE-1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag35074 Product name: Recombinant human CD3EAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC038992 Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：CD3EAP | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3?-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
