SMARCA4/BRG1 Recombinant monoclonal antibody Proteintech 83310-7-RR
$299.00
In stock
SKU
83310-7-RR
SMARCA4, 240172F7, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190
| Formulation::PBS, Azide, Glycerol | Formulation::PBS, Azide, Glycerol1 |
| Applications:Western Blot (WB) | Formulation::PBS, Azide, Glycerol2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, Glycerol3 |
| Type:CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species | Formulation::PBS, Azide, Glycerol4 |
| RRID:SMARCA4 | Formulation::PBS, Azide, Glycerol5 |
| Storage Buffer:Liquid | Formulation::PBS, Azide, Glycerol6 |
| Background Information:SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. | Formulation::PBS, Azide, Glycerol7 |
| biogegep8 | Formulation::PBS, Azide, Glycerol8 |
| biogegep9 | Formulation::PBS, Azide, Glycerol9 |
| Formulation::PBS, Azide, Glycerol0 | Applications:Western Blot (WB)0 |