NMI Recombinant monoclonal antibody Proteintech 83986-2-RR
$299.00
In stock
SKU
83986-2-RR
241135A9, N myc (and STAT) interactor, N myc and STAT interactor, N myc interactor, N-myc and STAT interactor
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：NMI | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
