NME2 Recombinant monoclonal antibody Proteintech 85074-4-RR
$299.00
In stock
SKU
85074-4-RR
242698C3, C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6, Histidine protein kinase NDKB
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：NME2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. Refer to the epitope and protein detection, this antibody specifically recognizes NME2. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
