Neurogranin Recombinant monoclonal antibody Proteintech 83593-5-RR
$299.00
In stock
SKU
83593-5-RR
NRGN, 240526B9, hng, NEUG(55-78), Ng
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag0676 Product name: Recombinant human NRGN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC002835 Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：Neurogranin | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Neurogranin (formerly designated p17, also known as Ng, RC3 and BICKS) belongs to the neurogranin family. It is a neuron-specific substrate for protein kinase C (PKC). It is a postsynaptic protein that is highly enriched in brain, with restricted expression in the cortex, striatum, hippocampus, thalamus, hypothalamus and olfactory bulb nuclei. Neurogranin binds calmodulin at low levels of calcium, thereby regulating calmodulin-dependent nitric oxide synthase. Neurogranin acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
