IMUP Recombinant monoclonal antibody Proteintech 84148-7-RR
$299.00
In stock
SKU
84148-7-RR
241220A4, C19orf33, H2RSP, HAI-2-related small protein, Hepatocyte growth factor activator inhibitor type 2-related small protein
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag22218 Product name: Recombinant human C19orf33 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC060319 Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：IMUP | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
