FAM116A Recombinant monoclonal antibody Proteintech 83473-3-RR
$299.00
In stock
SKU
83473-3-RR
DENND6A, 240486B9, DENN domain-containing protein 6A, Protein DENND6A, Protein FAM116A
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：FAM116A | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：FAM116A has DENN-related domains, which are required for cell migration. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
