DDX60 Recombinant monoclonal antibody Proteintech 82969-1-RR
$299.00
In stock
SKU
82969-1-RR
230293C10, DEAD box protein 60, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX60
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34406 Product name: Recombinant human DDX60 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：DDX60 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：DDX60, also called FLJ20035, is an IFN-inducible gene that has been identified via a microarray analysis of genes induced by viral infection in human dendritic cells (DCs). DDX60 expression correlated strongly with immune checkpoint and immune system-related metagene clusters, and DDX60 promoted cell proliferation, migration, and invasion and was related to poor prognosis and immune resistance(PMID: 37274827). Involved in RIG-I-dependent and independent innate immune responses, DDX60 has been proven to be associated with the development of tumors. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
