Anti-Human CXCL4/PF4 Rabbit Recombinant Antibody Proteintech 98410-3-RR

$299.00
In stock
SKU
98410-3-RR

 

CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4

Formulation::PBS, Azide Formulation::PBS, Azide1
Applications:Flow Cytometry (FC) (INTRA) Formulation::PBS, Azide2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide3
Type:CatNo: Eg2129 Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-101 aa of NM_002619.4 Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species Formulation::PBS, Azide4
RRID:5196 Formulation::PBS, Azide5
Storage Buffer:P02776 Formulation::PBS, Azide6
Background Information:CXCL4, also known as platelet factor 4 (PF-4), is the oldest member of the chemokine family. CXCL4 is a chemokine produced by activated platelets and immune cells involved in pathological conditions such as cancer, infections and inflammatory diseases like systemic sclerosis (SSc), rheumatoid arthritis (RA) and psoriatic arthritis (PsA), among others. CXCL4 is present in the α-granules of platelets in amounts that constitute up to 2% platelet protein mass. CXCL4 plays a determinant role in distinct physiological processes such as in hematopoiesis, angiogenesis, coagulation and modulation of immune responses. For instance, CXCL4 can prevent monocyte apoptosis and promote cell survival, induces the production of TNF and reactive oxygen species (ROS) and promotes monocyte differentiation into a unique macrophage-like phenotype. Formulation::PBS, Azide7
biogegep8 Formulation::PBS, Azide8
biogegep9 Formulation::PBS, Azide9
Formulation::PBS, Azide0 Applications:Flow Cytometry (FC) (INTRA)0

 

 

Reviews

Write Your Own Review
You're reviewing:Anti-Human CXCL4/PF4 Rabbit Recombinant Antibody Proteintech 98410-3-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.