CDK8 Recombinant monoclonal antibody Proteintech 83621-6-RR
$299.00
In stock
SKU
83621-6-RR
K35, EC:2.7.11.22, Cyclin-dependent kinase 8, Cyclin dependent kinase 8, Cell division protein kinase 8
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：CDK8 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Formulation:：PBS, Azide, Glycerol7 | |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
