FAM136A Recombinant monoclonal antibody Proteintech 84150-2-RR
$299.00
In stock
SKU
84150-2-RR
241433D12, Protein FAM136A
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34058 Product name: Recombinant human FAM136A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC014975 Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：84908 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
