FcZero-rAb? PE Anti-Rat CD8a Rabbit Recombinant Antibody Proteintech PE-FcA98484-2
$299.00
In stock
SKU
PE-FcA98484-2
CD8, CD8 antigen 32 kDa chain, CD8a molecule, OX-8 membrane antigen, T-cell surface glycoprotein CD8 alpha chain
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg3839 Product name: Recombinant Rat CD8A protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-189 aa of NM_031538.2 Sequence: QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：24930 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084). | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
