FcZero-rAb? Biotin Anti-Mouse BTLA/CD272 Rabbit Recombinant Antibody Proteintech Biotin-FcA98246-2
$299.00
In stock
SKU
Biotin-FcA98246-2
B- and T-lymphocyte attenuator, B- and T-lymphocyte-associated protein, Btla, CD272
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1843 Product name: Recombinant Mouse BTLA protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-176 aa of AAI08964.1 Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：208154 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide6 |
| Background Information：BTLA, also known as CD272, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
