Anti-Pig CD8b Rabbit Recombinant Antibody Proteintech 98700-1-RR
$299.00
In stock
SKU
98700-1-RR
CD8 subunit beta
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg7161 Product name: Recombinant pig CD8B protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-168 aa of / Sequence: LLQTPSSVMAQTNQTVKLSCEARTFPTNTRIYWLRLRQAPSANSHYEFLALWIPNGNPVYGKETEKQLTVLQDSSRYLLQLRHVKPADSGNYFCMAVGNPELTFGKGTRLSVVDVFPTTAQPTKKTRPKKKICRLPNLVPPKGPACAP Predict reactive species | Formulation::PBS, Azide4 |
| RRID:396636 | Formulation::PBS, Azide5 |
| Storage Buffer:F1SVD7 | Formulation::PBS, Azide6 |
| Background Information:CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC)0 |