Anti-Mouse TNFSF18 Rabbit Recombinant Antibody Proteintech 98423-5-RR
$299.00
In stock
SKU
98423-5-RR
GITR ligand, GITRL, Glucocorticoid-induced TNF-related ligand, Tumor necrosis factor ligand superfamily member 18
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2850 Product name: Recombinant Mouse TNFSF18 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 47-173 aa of NM_183391.3 Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：240873 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q7TS55 | Formulation:：PBS, Azide6 |
| Background Information：TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
