Anti-Mouse S100A9 Rabbit Recombinant Antibody Proteintech 98505-5-RR
$299.00
In stock
SKU
98505-5-RR
Cagb, Calgranulin-B, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, Mrp14
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2600 Product name: Recombinant Mouse S100a9 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 2-113 aa of NM_001281852.1 Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20202 | Formulation:：PBS, Azide5 |
| Storage Buffer：P31725 | Formulation:：PBS, Azide6 |
| Background Information：S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
