Anti-Mouse IL-28A Rabbit Recombinant Antibody Proteintech 98388-1-RR
$299.00
In stock
SKU
98388-1-RR
Ifnl2, IFN-lambda-2, Il28a, Interferon lambda-2, Interleukin-28A
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3169 Product name: Recombinant Mouse IL-28A protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 20-193 aa of NM_001024673.2 Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：330496 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q4VK74 | Formulation:：PBS, Azide6 |
| Background Information：IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
