Anti-Mouse Dectin-1 Rabbit Recombinant Antibody Proteintech 98597-1-RR
$299.00
In stock
SKU
98597-1-RR
Beta-glucan receptor, Bgr, CD369, Clec7a, Clecsf12
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2676 Product name: Recombinant Mouse Dectin-1 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 71-244 aa of / Sequence: GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：56644 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q6QLQ4 | Formulation:：PBS, Azide6 |
| Background Information：Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells, and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants, and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
