Anti-Mouse CD367/CLEC4A Rabbit Recombinant Antibody Proteintech 98688-2-RR
$299.00
In stock
SKU
98688-2-RR
CD367, Clec4a, Clec4a2, Clecsf6, C-type lectin domain family 4 member A
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg5258 Product name: recombinant mouse CD367/Clec4a protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 70-238 aa of NM_001170332.1 Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：26888 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9QZ15 | Formulation:：PBS, Azide6 |
| Background Information：CLEC4A (also commonly referred to as DCIR) belongs to the C-type lectin receptor (CLR) family and functions primarily as an inhibitory receptor in the immune system. It is a type II transmembrane protein containing a C-type lectin-like domain (CTLD). Uniquely among most CLRs, it possesses an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic tail (PMID: 35017526). Mice lacking Clec4a2 or Clec4a4 are highly susceptible to autoimmune conditions such as experimental arthritis and experimental autoimmune encephalomyelitis (EAE) due to excessive DC activation (PMID: 27068492). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
