Anti-Human TNFSF12 Rabbit Recombinant Antibody Proteintech 98582-1-RR
$299.00
In stock
SKU
98582-1-RR
CD255, DR3LG, hCG_1991317, HCG1991317, isoform CRA_b TWEAK Tumor necrosis factor, Ligand
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2870 Product name: Recombinant Human TNFSF12 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 93-249 aa of NM_003809.2 Sequence: RSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：8742 | Formulation:：PBS, Azide5 |
| Storage Buffer：O43508-1 | Formulation:：PBS, Azide6 |
| Background Information：TNFSF12, also known as TWEAK (TNF-like weak inducer of apoptosis), is a member of the tumor necrosis factor ligand superfamily. It functions as a cytokine by binding to its primary receptor, Fn14 (TNFRSF12A), and plays diverse roles in immune regulation, angiogenesis, tissue repair, and inflammation (PMID: 39905000). TNFSF12 is upregulated in multiple solid tumors and promotes cancer cell proliferation, invasion, migration, and epithelial-mesenchymal transition (EMT) (PMID: 28639899). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
